DPCstruct | MC35740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 258 ± 38 aa |
| Standard deviation of domain lengths | 38.38 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 33.70 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0550- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D8XTY8 | 57-285 | CRSMGYSDGGFYKWYLRNNDTYPFVLPRPGCHSAVKSLWDCPGLKDPNSIRLSENLCQGEDDLGIICWGQPTFRGWARHWKGIEIFN… |
| A0A183HDY2 | 1-207 | VVCRELGFDNGNVYEWLTPRWNYNPKIIIRKSYVVPRQCTGIELKLEQCPIRMSNNLSMWQCIDNEHFNYIHCGEQTILNSDYIGNW… |
| A0A6V7U868 | 1-301 | None |
| A0A0M3INI1 | 1-273 | None |
| A0A0N5CR55 | 304-561 | None |
| A0A5J4NTP3 | 13-211 | None |
| A0A238C4N5 | 589-879 | None |
| A0A158Q5A1 | 1887-2159 | None |
| A0A1I8EUZ8 | 16-305 | None |
| A0A6A0GUL9 | 518-742 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.