DPCstruct | MC35738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 132 ± 31 aa |
| Standard deviation of domain lengths | 30.90 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 82.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 58.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183WV43 | 5-103 | EEYASTPVHTLDHLEYFALLQSLSLDYRLTDPFVSLGCLSPIQRHLLDEYCTRYGIRECQRHLAMLINLLNKIENGMTIDPDLIHIS… |
| A0A183HDC6 | 34-143 | QGFADKASKHGMDELIQADPINFDHDHLFCKLQSLTLDFQLNEPICSLGWFSPGQVFVLDEYCARYMVRGCHRHVSFLNDLLNKTDE… |
| A0A3P7WSE6 | 612-750 | None |
| A0A3P7L9R4 | 4-113 | None |
| A0A7E4RQ26 | 539-648 | None |
| A0A132A995 | 78-186 | None |
| A0A183RU94 | 66-181 | None |
| A0A7J7KTE2 | 727-842 | None |
| A0A0S7FIK5 | 60-214 | None |
| A0A060X1P4 | 2-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.