DPCstruct | MC35735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 124 ± 11 aa |
| Standard deviation of domain lengths | 10.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 34.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08638 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K1K4M5 | 21-144 | GKAESHEPSLEQLESELPLVMDDQLPLGELVSRLAQAVYAELVEMAETMPSMSDAARKRYVADWVIRTKRQVVKLYAIAKWSRDAAV… |
| A0A183HC69 | 1-123 | MDDEEYMKPMLPTVPEKCGPPVIPLGHLIEFAVQQIFHELTVLSELLPKKLDSDRKISIVQFAHSTRVLFIKLLAVVKWVKSSKKFE… |
| A0A1X7TVP4 | 4-105 | None |
| A0A819P3K7 | 193-309 | None |
| P0CB66 | 47-179 | None |
| A0A6J0EFA2 | 25-143 | None |
| A0A1Y2GIS7 | 38-177 | None |
| A0A817D8W5 | 5-121 | None |
| A0A0C2N6G2 | 4-106 | None |
| A0A1I7RJG6 | 17-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.