DPCstruct | MC35727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 375 ± 36 aa |
| Standard deviation of domain lengths | 35.92 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 16.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09531 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183H839 | 51-398 | SISQWFQHIVFLRILKAIICFGLYCVAVYFIAACILQISLLHPIQAVLDCSLLLFSFRSSMYALLFAIFGAIHAALLAFFVLRFDNE… |
| A0A6A4TSR4 | 529-917 | KHSFPTYGNGYHHDKKTFMHDDAKVICWRAAASIAWAVLLLPPVTAVFVILSRFSLLHPIHTISECFSLLTSAGAIFSLILLCGVIL… |
| A0A1A6HDN4 | 23-349 | None |
| T1FTJ6 | 13-403 | None |
| A0A3B6PM50 | 1-351 | None |
| A0A6P5VEF2 | 25-379 | None |
| A0A2P4VB33 | 406-794 | None |
| A0A6P3UI04 | 5-321 | None |
| G0W7I1 | 89-496 | None |
| A0A369HAJ1 | 1-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.