DPCstruct | MC35723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 97 ± 3 aa |
| Standard deviation of domain lengths | 3.39 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 81.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1RNU0 | 1-101 | MAKVKPASFINSIHGRIGNIIFYNVNGSQYARSYTIPANPRTEEQQNNRMRFADAVKLWQQLSDEEKSVFNTRAEGTPLSGYNLFIS… |
| X1QJ28 | 1-97 | MAKVKGPLMSFDARGQIAKTLVYLGWKGLKTVRQYVIPANPKTDDQKLQRNYFKAAVAEWHTDGFTDLDAEAWDLYALALKVAKSGF… |
| A0A822IUP4 | 1-96 | None |
| A0A497PPT2 | 1-91 | None |
| X1BRQ5 | 1-100 | None |
| A0A497A3V8 | 1-96 | None |
| A0A1I4MPA4 | 1-92 | None |
| A0A2H0XBU6 | 1-101 | None |
| X1GRU4 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.