DPCstruct | MC35722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 318 ± 63 aa |
| Standard deviation of domain lengths | 62.66 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1RMD1 | 54-363 | ITAEVRQKGIFKIPFYTANLIIKGSFNNTPWREGKQTLNLSIFNNNSVEIKYVRINGAEVPFTLKSNNSIPNALTIGNYTADRLKTN… |
| A0A7C3FKP5 | 2-329 | KATIRPGDDQMVAQVEVSLTIEGTERTSQQIELRIKPLGTVQPEAIELAVDGTSLPLEPTDSPGISRSRMTLRPGRRTELRLRYTYP… |
| A0A2V6F459 | 2-305 | None |
| A0A2G8TD96 | 561-963 | None |
| A0A2G6GW90 | 53-441 | None |
| A0A7C7C1W4 | 2-232 | None |
| A0A2D5XNJ6 | 2-398 | None |
| A0A378QTQ1 | 57-486 | None |
| A0A7Y4T2Z3 | 18-267 | None |
| A0A1V5QH41 | 37-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.