DPCstruct | MC3572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 113 ± 9 aa |
| Standard deviation of domain lengths | 9.48 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5H4B2 | 278-386 | KRQHLESIMFHSTGDNRKKMEKLMETIGCCQKTWYQTYTGNQVRIILRKENIDGIFSILPDTEENGNVKEAMYSLAEIMSCSDALSY… |
| A0A2G5VF49 | 4-120 | RLDETKEGLGQAQENYDQLMAAVGGRGGVREELELVWHELGADISAWQHNFCRNQTMKLLQEKAIEKYIDVFPITSSLHHLKKFLVS… |
| A0A2H2HZX2 | 560-670 | None |
| E3MTK3 | 407-531 | None |
| A0A2H2J4Y0 | 4-112 | None |
| A0A2H2J2J8 | 20-136 | None |
| A0A2H2IUQ8 | 12-114 | None |
| K7IKY8 | 144-245 | None |
| A0A2H2IFW3 | 501-625 | None |
| A0A2H2I494 | 28-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.