DPCstruct | MC35719
Metacluster Properties and Pfam Annotations
| Number of structural domains | 113 |
|---|---|
| Mean domain length (aa) | 141 ± 21 aa |
| Standard deviation of domain lengths | 20.90 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U9RPF7 | 7-137 | RTSRTRPTRDAREVFLEHLRKTSNVSESARVAVVGRTTVHEWRDQDPAFAAAWDDAIDEATDALEAEARRRAVDGHEEYVISMGQIV… |
| A0A318QK00 | 2-118 | FLDHLRKTANITEAARIAVVARRSVYEWRDADPAFAAAWDDAIDEATDLLEAEARRRAIEGDEEYVVSMGQLVRDPKTGEYLTTRKR… |
| A0A3C1G7W3 | 2-133 | None |
| A0A021X473 | 79-241 | None |
| A0A2G4II48 | 21-147 | None |
| A0A844Y0M0 | 8-139 | None |
| A0A074ME50 | 1-150 | None |
| A0A376DUJ4 | 2-125 | None |
| A0A0Q4KV01 | 16-127 | None |
| A0A2M7HHG6 | 17-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.