DPCstruct | MC35716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 160 ± 18 aa |
| Standard deviation of domain lengths | 17.60 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7JBK5 | 8-156 | AKIANSMVSTWQGPPAMKSLFTRMFCCKSCPNIVRTNNFINFQSYFLQKTMPVAMALLRDVQNLCPKDVLNFILDLIKYNDNRKNKF… |
| A0A067FM29 | 244-413 | VNTLNNFLSDSKAFWRVRIEAAYALANTASEETDWAGLLHLVKFYKSRRFDENIGLPRPNDFRDFSEYFVLEAIPHAVAMVRAADNK… |
| A0A0V0Y2J9 | 211-379 | None |
| A0A0S7JDC8 | 4-157 | None |
| A0A0S7JDW3 | 177-333 | None |
| A0A1S3MJ25 | 364-502 | None |
| A0A368EWR0 | 1-140 | None |
| A0A820X6V3 | 368-545 | None |
| A0A836DB55 | 509-678 | None |
| A0A0D8YDS2 | 59-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.