DPCstruct | MC35714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 119 ± 15 aa |
| Standard deviation of domain lengths | 15.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11878 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7JB74 | 21-133 | YKNPAEAEVDSVPQVVVKPKVIEPLDYENVLVQRKTQILSDVLRDMLQFPLEDFEISTLRRQGRTLYPTVPENAEREAQSLFVQECI… |
| A0A0P4WEH0 | 18-130 | QVRENVSQAVKATATQVKPRLADPIDFEDYVSKNKIMLNNDTLRELLLYPPDDMSHCVVPRVTRTLQSLASVHLQEDITNPLVRQCL… |
| A0A368FPF1 | 1-126 | None |
| A0A0D8XDN4 | 50-177 | None |
| A0A4W5P3N7 | 9-118 | None |
| A0A3B5L5B6 | 24-135 | None |
| A0A3B3YN94 | 10-128 | None |
| W2SY72 | 4-151 | None |
| A0A3B3I8Z8 | 6-105 | None |
| A0A068Y780 | 11-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.