DPCstruct | MC35708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 880 |
|---|---|
| Mean domain length (aa) | 95 ± 19 aa |
| Standard deviation of domain lengths | 18.94 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.78 |
| Pfam Score | 99.07 |
| Assigned Pfam label(s) | CL0221- CL0114- CL0539- CL0196- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7IMW4 | 7-97 | SCTESNFVEIIHNYCQKNNLCRPEFILVETSGPPHNRRFFSKLKIGTREYPVAEGKKIKEAEQKAAKLAWSALREQSDNDSKVSVGS… |
| A0A2P7P0M4 | 1-70 | NPKSALQEWAQGQGRPLPTYRVADRTGSDHAPTFTVEVSVQDVQPLTAQGRSRQEAEKAAATALLKREGV |
| A0A3B6MZM9 | 1-101 | None |
| A0A3B6NP58 | 1-108 | None |
| A0A3B6PJ76 | 2-82 | None |
| A0A1V5UX05 | 157-231 | None |
| A0A287DA24 | 87-205 | None |
| A0A4Y7L8A1 | 673-770 | None |
| A0A1S3Q5H9 | 387-471 | None |
| A0A4Y7JRR8 | 103-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.