DPCstruct | MC35703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 76 ± 5 aa |
| Standard deviation of domain lengths | 4.95 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 41.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A087EH95 | 1-79 | MTVHGRGGAWPRADFPVDAVNRFTRRGRDGREWSMMTVAMPPGCKVDGFDLGGWRYTGFMSSRMIRDHEGAGPVSVAFR |
| E0QAT7 | 15-85 | RWARVNFPNKFVHPHEYTARDGRVFDKMFVSIPPGVKINGVDVGGYAFDHFAKPREIEQKANGRPVAINFR |
| A0A430FEL9 | 308-388 | None |
| A0A261GCP8 | 126-203 | None |
| A0A2X1B2J1 | 1-82 | None |
| A0A1Y3RV92 | 2-82 | None |
| A0A086ZFB2 | 6-75 | None |
| A0A4S4F3H5 | 134-204 | None |
| A0A261FL48 | 14-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.