DPCstruct | MC35702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 273 ± 36 aa |
| Standard deviation of domain lengths | 36.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H2P6S1 | 16-283 | PAKLTAIIIAVIIVALAGIGGGYAYWTHHEGSAYHEAVAQAENADKALSKAVEQATATTYKADQLKEPKLLDKLDAAISKAKALKGI… |
| A0A087BF29 | 1-184 | MDGREVLSSCQQSASIYQAGVKRLEKTVAAASDALAITEDQVQDNQTVQNLRTAVDAAKRNRKPDAGCNAASFVDANRNHDMAFTKA… |
| A0A7G9XM34 | 4-309 | None |
| A0A4R0UXC0 | 113-437 | None |
| A0A095WMS2 | 4-320 | None |
| A0A4P6F0K4 | 19-285 | None |
| A0A1Q3PR33 | 168-451 | None |
| A0A2W5WW61 | 14-272 | None |
| A0A5M9ZJV4 | 846-1098 | None |
| A0A261GC62 | 76-364 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.