DPCstruct | MC35700
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 61 ± 2 aa |
| Standard deviation of domain lengths | 2.19 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.98 |
| Mean intra-cluster sequence similarity (%) | 91.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A650F2R9 | 217-278 | PRGWFTFAHLCFALLFFFGHIWHGARTIFRDVFAGIDADLDEQVEFGAFLKLGDTSTRRQSV |
| A0A6A4N2W3 | 304-362 | SPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFAGIDPDLDAQVEFGAFQKLGDPTTR |
| R7W9S7 | 186-244 | None |
| A0A0A0KVA2 | 373-432 | None |
| A0A5A7QQX8 | 188-245 | None |
| A0A830C908 | 217-276 | None |
| V7CWV1 | 1-66 | None |
| A0A5N6NK58 | 170-232 | None |
| A0A118JQ51 | 69-131 | None |
| A0A835MDL6 | 117-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.