DPCstruct | MC357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 263 ± 18 aa |
| Standard deviation of domain lengths | 17.84 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 52.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B2A0C9 | 452-703 | TTAAKVIGTGEVVGSDILHSNGNVFDQVLVTGAAEAITADWNLNQITRTSYIDIDGDIVQVEFSGPGTLSLVLDAATAPALAEKYNQ… |
| B1ZQF6 | 1-288 | MAPYLYRAVRVLTASCCIATSSVCTEAAVVTGDGLEIASGVHHPNGNIYDQVLLTGPSVTVDPDPGEVARVSFVDLNDDIVQVEFSG… |
| B2A0D3 | 135-405 | None |
| B2A0C7 | 438-708 | None |
| B1ZZ26 | 965-1255 | None |
| B1ZUL8 | 261-529 | None |
| B1ZSI9 | 880-1110 | None |
| B1ZTJ6 | 207-450 | None |
| B1ZS02 | 551-799 | None |
| B1ZP88 | 633-907 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.