DPCstruct | MC35698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 179 ± 20 aa |
| Standard deviation of domain lengths | 20.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.53 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0105- CL0244 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q6ADM6 | 1-166 | MAAGALFLTPAVPEILQTAADVGDVPVSQRSFEDKHTVEVVFSLAADTLITTQATGRITAFDCRSGSVFESGASNLSVDGSGVVNLA… |
| A0A429AP36 | 1-184 | MKGTEMKRMLVGLAAAAPPPQATADIVRGDLTDTTSLSSKITFTGEQAVRGHIAGTITAVATRGRPLRQGKVLYRVDRKPVVLMYGK… |
| A0A3P1XUK6 | 50-198 | None |
| I3WJH3 | 1-199 | None |
| A0A1U7MP21 | 2-148 | None |
| A0A3C2AZ48 | 230-415 | None |
| A0A1R4HYH2 | 2-187 | None |
| A0A2D9RMB4 | 1-216 | None |
| A0A346Y1M6 | 255-442 | None |
| A0A2U2RRU4 | 30-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.