DPCstruct | MC35696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 101 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10042 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9L7J1 | 30-143 | TQRRVLGWTPWWRWVSVIYRPWRTGDNLQASEALEQILTIGGTILVWGEPFDTGLGVHNVHQNQGDPLDSRWAASNGIWQDGAAAVR… |
| A0A1C3SEI1 | 18-104 | FLEEYANKAKNDQHAAIYVYGSKFDTGLGMHNIHMNQGNPRGSRWENDNGTWKDGGILIQFKDSWAAVFLAFQTQSWCTDRDGQPIK |
| F9FY44 | 127-212 | None |
| B8NMW0 | 10-105 | None |
| A0A5N7A836 | 1-95 | None |
| L2FHF4 | 146-244 | None |
| A0A420M824 | 70-169 | None |
| C2WX38 | 48-149 | None |
| A0A2E3IPD3 | 224-327 | None |
| A0A1F8AE72 | 115-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.