DPCstruct | MC35691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 198 ± 33 aa |
| Standard deviation of domain lengths | 33.32 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06799 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0PU51 | 16-254 | APLRRPGRSAAAPIWSPRPVLTVARAAGDGEGSLLDELDADARCPVPKDQRPASQFKELQDSPLLGWGGLELPGYLARLGFLGAFFF… |
| A0A6G3Z2T5 | 5-157 | CPVPIEQRPINQYQDISQSWFYSWGSREIWPYSKPLVVLWCMSWFVTGPVAAASFAPSKYPLPFVIWAAVGALLLPLLTLAQLYVGW… |
| K8F2C9 | 86-313 | None |
| A9TQ91 | 5-131 | None |
| A0A6P4BFF7 | 6-214 | None |
| A0A1P8BCZ9 | 41-190 | None |
| B8BSA7 | 1-192 | None |
| A0A830I5N8 | 67-289 | None |
| R1F5J8 | 28-257 | None |
| A0A2Z7CXK7 | 4-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.