DPCstruct | MC35687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 145 ± 14 aa |
| Standard deviation of domain lengths | 14.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 65.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9F001 | 89-221 | GGISSPDKVSTNSRAIVPVPPADSNAGVVVPANKSKRSLEQGQRRIRRPFSVSEVESLVLAVEKLGTGRWRDVKLRAFDNAKHRTYV… |
| A0A7S0KSM1 | 1-137 | GGGGGGGGDAGESSPGTDDDGANASEASMPASKGARRSKHHSPWTLTESEALVDGVESCAGCRWTVIKKLGLEALERRTAMDLKDKW… |
| C1FDC4 | 367-509 | None |
| A0A5B8MF78 | 192-335 | None |
| A0A803PWS8 | 686-823 | None |
| A0A4Y7KY80 | 803-951 | None |
| K8EGU2 | 756-901 | None |
| A0A287XDM8 | 4-150 | None |
| A0A5J5TYG9 | 210-358 | None |
| A0A811MSB6 | 53-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.