DPCstruct | MC35685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 217 ± 24 aa |
| Standard deviation of domain lengths | 23.90 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T5HUI7 | 1440-1624 | PTSPTLPILSEARRQLKLTQKFSAEFDGDELRFFARDLFEWYNSTKANHKERKTAEKQLKEYEVALDCIECAIHENLEMLKLGVVEN… |
| G0N840 | 12-218 | SLLKSKVNRLENEIARLREQASQALEPVVMDRRKLLELRKLKDDFGRNKIMEEAKEKMDKVKQLPDTTENLAGALEAAENELTRLET… |
| G0NEM4 | 444-678 | None |
| A0A2G5UQN3 | 966-1186 | None |
| A0A2G5UQC4 | 24-244 | None |
| G0P0N3 | 421-673 | None |
| G0NHU9 | 606-834 | None |
| G0NEM5 | 1-193 | None |
| G0N885 | 66-271 | None |
| G0P7A7 | 778-992 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.