DPCstruct | MC35683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 198 ± 19 aa |
| Standard deviation of domain lengths | 19.45 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 28.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0N3B9 | 74-286 | DSDNSEDQDKNEKTEGIIESVIHNAAVGFVVGAVKNAAHYIVKIGGRKSNIVTVFDKTVKSSLGNPKWFARVDMPHGNVPFHHINVN… |
| A0A1I7UR90 | 3-176 | SGGSIGSFRNYLQYSVKVGGRKSNVVHVYDYNFVSSLGNPKWFARVDMPHGKVGFPHINVNKAITGVKDPHIAISAMGARAAGVTGS… |
| G0N3C8 | 158-348 | None |
| A0A0N9HTH9 | 98-265 | None |
| E3MNU1 | 612-804 | None |
| A0A2A4F9M7 | 10-208 | None |
| A0A6L5CGJ7 | 3-209 | None |
| A0A267G944 | 1-199 | None |
| A0A157RMG6 | 37-263 | None |
| G0N3C9 | 21-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.