DPCstruct | MC35680
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Standard deviation of domain lengths | 7.50 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A502H4F9 | 2-69 | PLGEAEEWAHSIANEIYGRNYEGYITPDYKIAYVLSFRLAEVSEFRVHTKKDLANDDTFVYKVWVTLI |
| A0A7V7V5X0 | 1-78 | MKWKREDRIFETIREAEVWADSIANEMYGRVFDGYETPDYKIAYALSFFLAQNQDFTVHTEVSFKEEREIYKVWQNPV |
| A0A1M6LLP0 | 7-102 | None |
| A0A073K9N9 | 1-80 | None |
| A0A1G9K8W6 | 38-120 | None |
| A0A1H8ITL6 | 35-118 | None |
| A0A1B8VTG1 | 6-88 | None |
| A0A1B1N5Q5 | 26-103 | None |
| A0A1Q5XQJ8 | 1-75 | None |
| A0A0Q9V216 | 3-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.