DPCstruct | MC3568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 163 ± 34 aa |
| Standard deviation of domain lengths | 33.74 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5V9L5 | 1-108 | MSVLLDLQKFIEAYFYCHKCPIYTDEKIVDVHDYLFNPKEAQIPQIVSRLNGRTGLRLYECFMLKQGATNYMGQWKNNEELRAIWLT… |
| A0A2G5V9D3 | 29-149 | MIIAPPVVFGSREYILRWVEACERARTSPIYHDEKIVCRTSLFDPKRLDAIPQKVVNPVDAAMMYKQWRLEDNVHIDDGKKEWKSLS… |
| A0A6A5FUV1 | 16-182 | None |
| G0NKW9 | 423-546 | None |
| G0MMS9 | 138-280 | None |
| G0MD60 | 183-336 | None |
| B6IGW8 | 9-154 | None |
| A0A1I7V3B9 | 12-185 | None |
| A0A1I7V1K8 | 156-313 | None |
| A0A1I7V1L1 | 122-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.