DPCstruct | MC35673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 46 ± 5 aa |
| Standard deviation of domain lengths | 5.09 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 48.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0005 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y7CKD7 | 2-42 | VEMGPCTKEYMPVCGCDGLSYGNACEATNAGIQSYVEGICD |
| A0A7Y2C3A2 | 51-101 | PEGCIDESQIDPDMACAKIYMPVCGCDGKIYSNECEARRNGLTSWDEGPCK |
| A0A7W2B3X9 | 1-49 | None |
| A0A5C6UQI5 | 36-84 | None |
| A0A3C0E0S1 | 42-95 | None |
| A0A2D8KCM0 | 104-150 | None |
| A0A2E5XC71 | 397-448 | None |
| A0A2E1BZG8 | 12-48 | None |
| A0A2E3UTN1 | 1-44 | None |
| A0A3B9JU60 | 47-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.