DPCstruct | MC35671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 131 |
|---|---|
| Mean domain length (aa) | 145 ± 19 aa |
| Standard deviation of domain lengths | 19.20 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M4IMI2 | 129-262 | GTTVTYTAADGSTQEVSGTHPNRDNNPLDIRSGSFADDHGSLGNDRGFAIFSNPQAGLDAAVANMNRINDNNDGTATLSQIISTWSP… |
| A0A6I6QS21 | 5-150 | TPRGIRNFNPGNIRHAQGVRWQGMAAAQTDSAFVQFTAPRWGIRAIARVLITYQDKRLAKDGSRIDTVREFVERWAPPSENDTNAYA… |
| A0A6N7Y4W1 | 16-150 | None |
| A0A2N5LG99 | 271-414 | None |
| D7N3K7 | 13-196 | None |
| A0A4S0XVR0 | 18-149 | None |
| A0A2C5TJW1 | 68-171 | None |
| A0A1I7N9K0 | 13-175 | None |
| A0A4R0YGU1 | 98-237 | None |
| A0A3N5PIY3 | 211-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.