DPCstruct | MC3567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 155 ± 15 aa |
| Standard deviation of domain lengths | 15.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01579 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A8WNR5 | 5-126 | NTTCTDFLKCATKFKCGRTRKDVEEINKAVTLCDFHAFHLSPGWLDCVEKLDTTCVREWDPFPDLEGTEEENTVKQKEACRNFFGKD… |
| A0A2G5V8T0 | 2-145 | VFKELGEQAGHYNLTNKNSTVPTNELCGRFKRCAPTFSCDPEPKLVYAVNITILFCDAIGFFTNEFLPCQVKLDADPTECTRAWDPF… |
| O18088 | 8-146 | None |
| G0MA07 | 30-197 | None |
| A0A2H2IDV5 | 11-134 | None |
| A0A2H2IH80 | 19-172 | None |
| O45153 | 27-195 | None |
| A0A2G5TAK8 | 20-183 | None |
| A0A2G5T6X6 | 5-169 | None |
| A0A2G5T6Z8 | 3-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.