DPCstruct | MC35667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Standard deviation of domain lengths | 9.89 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A416PMK6 | 63-181 | IKYQQLYKYLCEKAGISCREVKCLSRPTYGWEENIENKSCNTKEEIERYYFRLGIHLFLGYALGATDLHGENIVAYGEHPVIIDMET… |
| A0A416BIL5 | 2-102 | KCLSRPTYGWEENIENKSCNTKEEIERYYFRLGIHLFLGYALGATDLHGENIVAHGEHPVIIDMETYPGYITKNSGSSTEEKAEIKI… |
| A0A828Z8G0 | 290-400 | None |
| A0A6I4MLC2 | 250-345 | None |
| A0A1V3XUW8 | 105-202 | None |
| A0A0X3VGE6 | 1-108 | None |
| A0A417GC86 | 3-104 | None |
| A0A421BH63 | 3-121 | None |
| A0A417DEQ1 | 177-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.