DPCstruct | MC35665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 736 |
|---|---|
| Mean domain length (aa) | 125 ± 20 aa |
| Standard deviation of domain lengths | 20.23 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.76 |
| Pfam Score | 96.59 |
| Assigned Pfam label(s) | PF07833- CL0020- CL0317- CL0105- CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N1ZL26 | 20-140 | TMAFTVFAGSKISINDIMLCIETVAVDDVAMVSLRDIYECFGANITWQADTQEIVVVNTDKTIKFKVNSATATVNNVPVTLSHAVIQ… |
| A0A645CLT8 | 4-135 | PNTSSVLINGKKVDFESYNIDGFNYFKLRDIALALKDTGKGFEVEWDGNKNSVSMKSYSSYTQVGGELSLPESYLNKQALVSTVLLY… |
| A0A3B0C4E6 | 6-186 | None |
| A0A1E3C1K1 | 136-299 | None |
| A0A7X9B9E9 | 779-897 | None |
| A0A7X9GC16 | 2-92 | None |
| A0A1V5XF81 | 18-143 | None |
| A0A1V5XJ98 | 513-626 | None |
| A0A1C6GIM4 | 517-656 | None |
| A0A5C4SW88 | 81-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.