DPCstruct | MC35663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 137 ± 19 aa |
| Standard deviation of domain lengths | 18.93 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 41.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3ANE7 | 1-148 | MDPVKSVEFNHHLRLWEGLVLHNPKGSSLPTHEHVVSLLDALANPLEDKYLITTVVQCSDCHFSNSSKFNTMRKTRPRHNNGYSGCW… |
| A0A0C3NYM6 | 358-460 | GKLLALHQPKGLSLPTNWQVVRLLKALSTRLAGKHLVITVVQCSGFYGVGDDEPQILTPLCTIVRPQVWQRQLPCVERRERFKSIRE… |
| A0A0C9YFR6 | 122-243 | None |
| A0A0C3AGW2 | 107-240 | None |
| A0A0C9YYV5 | 48-201 | None |
| A0A0C3MYN5 | 331-485 | None |
| A0A0C3NYS8 | 47-174 | None |
| A0A0C3NJA0 | 1-170 | None |
| A0A0C3ND34 | 177-325 | None |
| A0A0C9Z146 | 411-528 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.