DPCstruct | MC35662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 154 ± 29 aa |
| Standard deviation of domain lengths | 28.61 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3AEM4 | 240-389 | QQFFARQEERHARIVEHESLADKAKREACTAAKRVPGRNRGARIYIWPVQVANEQVFRLCEPINRHDGVSMMENYTEKQMRYNAFDN… |
| A0A6A4HJA0 | 228-355 | LTAFLERRERYSLKLIAAETADECQSRLDREANARKGSPPGWTGARVFYWELINGERVRIPQGRNDFQSLWERYSSDQRRYDSVTDE… |
| A0A5C2THR0 | 247-406 | None |
| A0A2H3BEJ0 | 214-328 | None |
| A0A4Y7T3H3 | 2-147 | None |
| A0A4Y7TFJ7 | 88-223 | None |
| A0A2G8RW96 | 207-374 | None |
| A0A2G8S9A8 | 222-425 | None |
| A0A4Q2D6D8 | 139-289 | None |
| A0A369J9N7 | 1-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.