DPCstruct | MC3566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 98 ± 5 aa |
| Standard deviation of domain lengths | 4.53 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 38.39 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | CL0529- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3JJY4 | 1-94 | MGLSLHPKYGGHFSFRGVIVFPDVRLLDSYKENAPIRTLKSEESVEEALKLFNDSYFDNRYRDCGSPLKKHGELQLKYFNTPPEKRW… |
| A0A2G5V5H5 | 5-107 | KFIGLSLHPIYGGHFAFRSVLIFPNVLIPDFRESVPRPILKEASEVRTALEKFNYNWKDSGFRDFGNPSRRYSTTQMEFFGRPVAER… |
| A0A6I9HJV8 | 91-183 | None |
| A0A5S6QJH1 | 141-241 | None |
| A0A2G8L118 | 237-330 | None |
| A0A0M3IF23 | 409-506 | None |
| A0A444SVT6 | 149-243 | None |
| A0A7E6EMC9 | 149-244 | None |
| A0A0B2VLI2 | 18-113 | None |
| E4YSX8 | 33-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.