DPCstruct | MC35657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 133 ± 21 aa |
| Standard deviation of domain lengths | 20.75 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2ZCB2 | 19-123 | PKPVIPDVPPRDHSPKMPRSKAWKEVMHHWLEGVPELNLHIPLKDWPYEYMCGLNCGLHSKYNQRHIIVMEFLNQYGGNKTAFMAAY… |
| A0A0C3PK69 | 1-103 | MPVLHPDGTQTAKLDSWRDIVHHWMEGEPQLDLHIPLKDSPYHYYNGKSGRQFNTKYSQRCVIVTEFLDEFQGDEETLLKIYGSAIG… |
| A0A0C3D4J5 | 672-793 | None |
| A0A0C2ZHQ4 | 122-276 | None |
| A0A0D0A3V2 | 436-568 | None |
| A0A0C9YWD9 | 294-426 | None |
| M2QG18 | 266-440 | None |
| D6RQS8 | 137-297 | None |
| A0A409WUU4 | 1039-1167 | None |
| A0A0C9X269 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.