DPCstruct | MC35656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 104 ± 7 aa |
| Standard deviation of domain lengths | 7.28 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 70.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0363 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3TIL3 | 189-295 | MDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWPVSRPSLLADTKDTMDGTTTQKYWIDVQLRWGDYDSHDVE… |
| A0A0C2YYA8 | 169-272 | MFDQELEPLQIETVQKETIHPRKSYKINLSCVDILLFSAYKWNITQPSLVTDNKDVLDSTTSNKYWIDVQFCWGNFDLHDIKQYTHT… |
| A0A446MUL0 | 44-149 | None |
| A0A822DI53 | 1-94 | None |
| A0A1D6FVM4 | 788-883 | None |
| A0A816R4S7 | 1-112 | None |
| A0A7J7IG76 | 90-198 | None |
| A0A482S0J1 | 252-358 | None |
| C9SPU0 | 79-187 | None |
| A0A0C3ERV1 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.