DPCstruct | MC35655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 164 ± 24 aa |
| Standard deviation of domain lengths | 23.66 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0430 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2EBA9 | 37-213 | HILKPGQTKYTMSEHTTPIRLAQATSILVATALAGANAGLSFFVIPRLLESPTPLMIRQWGNMFAITHRYLPSLFMLPGFINIWLAY… |
| A0A386Z758 | 4-158 | LTCQILAALAVLANAVVYGTDWSVALITRSVYRDHLDDATMTISAGWGHYYGDKRMPLFGAGGVITAALALILAALAGQTAATLAAA… |
| A0A3M7HCH0 | 1-219 | None |
| A0A1L9V0J4 | 96-255 | None |
| A0A366RCS4 | 248-405 | None |
| A0A4Q5X9A1 | 7-158 | None |
| A0A146FRK3 | 2-169 | None |
| A0A6A7AJE5 | 1-189 | None |
| A0A2V1D4H3 | 4-173 | None |
| A0A3L7PF65 | 91-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.