DPCstruct | MC3565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 131 ± 21 aa |
| Standard deviation of domain lengths | 20.56 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q7YWP9 | 14-121 | LNTINSLYQWENRILKCENANCSLQKTGEEFKPAVCEKDSNGKIACDIECDKADRDSVISKRPTDYRYCNRFYTYNAEKTSDGKYVI… |
| A0A2G5V5B9 | 20-144 | VLIKVNAAPPNGSFHWIDREISCTSYGVNRTRCVLNHPQLGPEQNPECFDEIDANGVKLKTFCALGCEESLEAQLVKKIPSNSPSCV… |
| A0A0B2VB15 | 130-267 | None |
| A0A0B1TBJ5 | 5-142 | None |
| A0A6V7WWX1 | 10-193 | None |
| A0A1I7YWI0 | 8-152 | None |
| A0A183FUI8 | 64-207 | None |
| A0A0B2UXZ5 | 2-126 | None |
| W2SXD4 | 44-166 | None |
| A0A0B1SL66 | 19-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.