DPCstruct | MC35643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 130 ± 16 aa |
| Standard deviation of domain lengths | 16.25 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L9XWG7 | 6-129 | ASTGTAVNTDVDLDDEELLEKAMNASNGTKFERLWNGNMAGYESQSEADMALCCLLAFWTGGDHTRVDQLFRQSGLLREKWDEVHYA… |
| A0A2E3I0N0 | 1-101 | MTNFNDTKLLDVAMKDDKFSSLWFGSWESNSDSLNIDYPTQYVAELELCKKLAFYWGKDFRTIDRMFQRSGLYCEKWDELKYKNRVI… |
| A0A0G0GX30 | 96-232 | None |
| A0A6A9SW11 | 277-407 | None |
| W0JXZ7 | 44-184 | None |
| D7CQE3 | 160-272 | None |
| A0A3A4ZXF5 | 25-145 | None |
| M0CUZ9 | 105-262 | None |
| A0A1V5M4X1 | 3-128 | None |
| A0A2H6HS62 | 211-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.