DPCstruct | MC3564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 176 ± 24 aa |
| Standard deviation of domain lengths | 23.99 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 66.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5V4T8 | 1-150 | MSLNFFKFNCVEPTCKFHDKLHLHCGQIRCHFASNDPLIISNHISVFHPENADIPEDRELYHIDVSCASDTCQFNTSSTHWHCIRCQ… |
| A0A803SRU8 | 520-728 | YHGCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTVDCQFYGQKTTHFHCRRPGCTFTFKNKC… |
| A0A4E0RY15 | 880-1074 | None |
| A0A5N5T423 | 626-798 | None |
| T1KU98 | 699-834 | None |
| A0A4W3H7Y7 | 260-460 | None |
| A0A7R9GT63 | 309-465 | None |
| A0A6P6Y718 | 377-559 | None |
| A0A671MH35 | 118-318 | None |
| A0A7R8VAU9 | 91-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.