DPCstruct | MC35639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 133 ± 19 aa |
| Standard deviation of domain lengths | 18.83 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09509 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M7G5Y5 | 148-285 | VPRVLSQVEQQEITRQYLHSLTFLHPEVLSVSGDLIKDGHYRSAILDAYIHLIQNVKEKSGITDRDGVPLIQQAFGTMTPSLRISNN… |
| A0A7M3JRP1 | 5-129 | WRHLHKTVQEVSKTDYEKADYLRAALEAAKRYEKIVQQKSNISETGAKLMFAAFGQNGKLKVTPYLTETDKNIEVGQQNLSVGVVSG… |
| A0A7X7IH31 | 4-119 | None |
| A0A2V5Z4L2 | 24-185 | None |
| A0A6V7BAU9 | 2-90 | None |
| A0A3B6VGL5 | 5-134 | None |
| A0A6P1TT01 | 5-111 | None |
| A0A0N1JF08 | 354-490 | None |
| A0A318RAM0 | 123-285 | None |
| A0A7V4W7Q1 | 25-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.