DPCstruct | MC35637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 343 ± 41 aa |
| Standard deviation of domain lengths | 41.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5K8S9 | 17-335 | AAVLAHATPRGLAAFAQQGPEQAALVGKLLADDKLMKEMLIAGGASYGHYGRAMEIYTAIQKASPKAGEGVLQRLALAVALEHAQPI… |
| Q3F0E9 | 2-339 | KNTDVMNTYLEGGSPTGKNPVNALEIWNTIWNADANSHEGLYLKLAIATSLAHAEPIKYWTNNQPINPLTRYQHYKSADQNNELLPC… |
| A0A7V3ACZ2 | 2-261 | None |
| R7L6K1 | 31-437 | None |
| R1BRX9 | 103-408 | None |
| A0A6S7HHJ5 | 333-638 | None |
| A6DQZ4 | 52-391 | None |
| A0A355V1R5 | 274-672 | None |
| A0A7C3F4K3 | 163-455 | None |
| A0A352XK48 | 200-575 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.