DPCstruct | MC35636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 90 ± 15 aa |
| Standard deviation of domain lengths | 14.75 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01259 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453L0F5 | 129-221 | CLGETHLDLVVPGLRLAAKGKVRDVYESGEHLVLVTTDRQSAFDRVLASIPFKGQVLNETSLWWFNRTSHITPNAVVSSPDRNVTIA… |
| Q3ET89 | 16-106 | GACEMQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITGKGRLNNEITTLLFRKLQEVGIKTHLVEKLSETEQTCQK… |
| A0A1V5ZCC0 | 327-411 | None |
| A0A445AXI8 | 229-301 | None |
| A0A3L7IF28 | 69-130 | None |
| A0A820X689 | 248-337 | None |
| A0A0G4LYW7 | 805-914 | None |
| A0A3M7DPR6 | 224-329 | None |
| A0A2U3RSP5 | 3-82 | None |
| A0A1F6LHR9 | 437-543 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.