DPCstruct | MC35630
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 8.42 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842YXL8 | 1-85 | MRLAAGLWLGLFSAVTSTCDRKTCVVKGSGTNKTDDAPAVRQAFESCGHGGQVIFEESTFYINSVLNITGLKDVNVDVHGTLLVS |
| A0A2D5SKQ5 | 1-94 | MPSYNLLFSCLLFLGWVAAPSLASGLSNAGHRKICTVKPGGSNLTDDAPAILKAFRKCGHGGTINFLKKTYYINSVMNTTGLHDCEV… |
| A0A395IT10 | 7-99 | None |
| A0A1G4B3I0 | 9-110 | None |
| A0A1L9PC85 | 1-87 | None |
| A0A0G4N153 | 2-110 | None |
| A0A1S9DSR2 | 1-84 | None |
| A0A4S9YTN2 | 1-84 | None |
| A0A4V1Q2A3 | 9-106 | None |
| A0A5N7CC04 | 2-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.