DPCstruct | MC3563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 660 ± 61 aa |
| Standard deviation of domain lengths | 61.34 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q4GGU3 | 2-695 | FQSHVVESSKPGLVGAAAVLEFWVGILTQQNLWYRDKTVLFLMDQICCAAFTYHQEECVQKLLYQQHKTALGYHGDRGLLSSLVGWI… |
| A0A2G5UZJ8 | 16-618 | AVQWLSGPSSTPTPIVRLICSAISYYSAKLPPRDYLRAWITLLCQARTGWNEDAVTYQIVGTIVRIAFINDHQKLYEITSIVFQAYQ… |
| A0A0D6M1R2 | 449-1084 | None |
| V5H090 | 2-652 | None |
| A0A1I7W3S0 | 112-726 | None |
| A0A2J8MMK9 | 387-1050 | None |
| H9JVN8 | 41-795 | None |
| A0A2I0TI54 | 203-755 | None |
| A0A023GMB4 | 2-617 | None |
| A0A6J1RBD6 | 239-989 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.