DPCstruct | MC35629
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 132 ± 13 aa |
| Standard deviation of domain lengths | 12.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z1HFB9 | 93-228 | WQHLREIALEIQEIYENNMLDIMHEYSEHPTRPISEREVFVGNILGKVGSVSKKQRELCTSMKEKYDEIAAFIVNCIIKVNDEYSDE… |
| A0A2D5SIP3 | 1-115 | MLDIMINHSEHTLHSVSELEAFIGNILGRTGAQSKNQRELSTTMKDRFEEHSAFIVNCIVKDGSEWSEESLERSMACLAVSLEKKDV… |
| A0A2V1BQJ3 | 135-267 | None |
| A0A178ABD6 | 1-143 | None |
| A0A6A5ZQE0 | 1-111 | None |
| A0A6G1HVU5 | 161-288 | None |
| A0A0F4Z2C8 | 230-372 | None |
| A0A2I1CNU5 | 98-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.