DPCstruct | MC35628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 114 ± 11 aa |
| Standard deviation of domain lengths | 11.35 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 26.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A162JSW8 | 433-538 | NISDPIQKWASSDVKFIRISTGYSRKCIELRVRKFVPLEGDKLERTWDFEGRRRSVKIPPYALMDLDDGKSAYMSHIRDAMGDTLQH… |
| A0A2J6T5U6 | 131-232 | KDINVWASSETRTIKLTQDYVATPLTFQVRQFVPLESDMLDRRWAHGSVKKSVTLPPYAFANMREALEIYKDFINREGTRHLYSILD… |
| A0A507BIQ1 | 208-310 | None |
| A0A4Z0Z122 | 62-164 | None |
| A0A842Z425 | 37-171 | None |
| A0A842YXA2 | 1-122 | None |
| R8BHG8 | 186-309 | None |
| A0A2N6NEM8 | 1-105 | None |
| G2QXF0 | 254-374 | None |
| A0A084G008 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.