DPCstruct | MC3562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 145 ± 10 aa |
| Standard deviation of domain lengths | 9.84 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5UX09 | 49-206 | ILGFVGMMVSVWTLAGCILAVEYKFHIEVFAMLYIPVLCAFIAFYSMIFNAYKDLYLMLPTENRPFFGNKRYVVVFGLFHLSVAYGS… |
| E3LG98 | 106-246 | KPVVQKMIHVILGLFGMIVSIWIMILCVISWQFGFFQMASGFTFLIFLCCMAISYFFFSSCRTNLYICLPSENRPFSGVKSYVILFG… |
| A0A2G5UL02 | 101-233 | None |
| A0A2G5UCG7 | 2-139 | None |
| G0ML07 | 1-146 | None |
| A0A2P4V495 | 115-275 | None |
| A0A1I7TUU1 | 8-151 | None |
| B6ILQ0 | 5-135 | None |
| A0A6A5HVI1 | 282-429 | None |
| A0A6A5HFL5 | 2-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.