DPCstruct | MC35612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 193 ± 32 aa |
| Standard deviation of domain lengths | 31.80 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4JJH6 | 1-206 | MFAAIPTLLAVQFFLGAADLRLAPDDPAPEEEGRIDFDLFGDTAASQKGPIDPALDRQVQARRSMLQTHQILGLGTLGLMAGNAVVG… |
| A0A2E6S3R6 | 53-189 | KDELKLRVKMLQNHQKLALVSLGLIAYQSSLGNKMKEGDYTVREEHKRLSMITWGAYMTSASLSYFAPPAQKYDSKISSMKIHRWLS… |
| A0A2E7M680 | 17-232 | None |
| A0A3N5K7T9 | 29-223 | None |
| A0A534NLB4 | 1-191 | None |
| A0A521U8Z7 | 43-267 | None |
| A0A4P5TA35 | 20-156 | None |
| A0A7Y3BNU6 | 1-209 | None |
| A0A3B8LN38 | 70-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.