DPCstruct | MC3561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 253 ± 28 aa |
| Standard deviation of domain lengths | 27.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3CYQ2 | 3-251 | EVKLVLLWKHNMHIEYLAAASWPLEPTKRTTRVEVTMEGSYDILHDISCTQRKPITSPYRTSVIRRFWNTLQSINQTDQMLVHLQSF… |
| A0A2G5UVM3 | 17-246 | QVILTLRLAFRPLVFIDYIITSAWPVNKNVHQAVNVELVLEGPYNELKDLLTESNYLNPVRMNLIKSVIDGIIDADRLLLHIHSFDT… |
| A0A183H9T0 | 192-428 | None |
| A0A7E4RPS6 | 290-563 | None |
| A0A132A113 | 53-301 | None |
| A0A7R9EFA7 | 337-545 | None |
| J9E2U8 | 1-328 | None |
| A0A090LPA4 | 445-746 | None |
| H2YI44 | 3-240 | None |
| A0A067RR02 | 201-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.