DPCstruct | MC3560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 113 ± 11 aa |
| Standard deviation of domain lengths | 11.40 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U4VIP1 | 2-112 | QRFFNAIERAGNKLPHPVILFASLCVVVALLSWVLAIYGVSGVNPKTGASVTVKSLVSGEGLVFALTTVAKNFVMFPPLGVVLVIML… |
| A0A378WCD3 | 22-153 | MLPHPVTLFIIFIVLLLIASAAGAYFGLSVPDPRPVGAKGRADDGLIHVVSLLDADGLIKILTHTVKNFTGFAPLGTVLVSLLGVGI… |
| W4PB99 | 2-118 | None |
| T0CRU7 | 1-127 | None |
| A0A0G3HBD9 | 281-386 | None |
| A0A7X7LJ69 | 4-118 | None |
| K4X546 | 1-101 | None |
| Q5QZK6 | 8-113 | None |
| A0A485JIW8 | 1-104 | None |
| A0A1C5SPC8 | 4-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.