DPCstruct | MC356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 112 ± 39 aa |
| Standard deviation of domain lengths | 38.99 |
| Length coefficient of variation | 0.35 |
| Mean AlphaFold2 pLDDT confidence score | 88.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.98 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 55.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20106 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7WL63 | 1-124 | MPEKETLERARRDKAEGKAPSTQAGEFVREEIEHIREGKHGARSTKQAIAIGLSKARRSGVKLPPPTSGPSATKRKASSDLRKASSS… |
| B1ZPQ6 | 1-92 | MPTQTAKRRARSDARAGKKPSTQAGEFVREEMHQLKRGKGTAKSRKQAIAIGLSEARRSGVKLGTPKKGKTSSATRKKAQRDTAVGQ… |
| A0A4Q6EY61 | 1-135 | None |
| A0A2W7FJG7 | 1-213 | None |
| A0A7Y9SQE1 | 132-314 | None |
| A0A7T6XBY4 | 1-114 | None |
| A0A2V7XXV3 | 102-225 | None |
| B4CX90 | 98-189 | None |
| A0A2W4J0B0 | 1-88 | None |
| A0A4Q8L7P6 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.