DPCstruct | MC35598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 181 ± 16 aa |
| Standard deviation of domain lengths | 16.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A250J3Y9 | 3-165 | LAGLDDMISVHVQNFSSLLKDTNQLCSAIILFIDGMAIKGLAPHSCDMQTGHVRYLLLRTPQSHDVWKMLLGGPSGYVRPVSISVGS… |
| A0A108U4D8 | 1-176 | MNEIIQLNDIAKVTVANLKEWSATHDPAKLVPFIDGRAIRGNYPEEIHPHDGRLYFHLKITAANTELWTDLLGAPDSIQRPVRFSVG… |
| A0A522FVH3 | 31-221 | None |
| A0A1F2TWV7 | 45-250 | None |
| A0A6C0GIS4 | 25-179 | None |
| A0A2V5VZ83 | 5-192 | None |
| A0A357NI71 | 62-219 | None |
| A0A318JS70 | 21-216 | None |
| A0A7K1TBI1 | 75-271 | None |
| A0A4Y8SHF4 | 92-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.